Usage, resolution, format,
size in pixels and cm Single item
purchase Within
downloads pack Download
forcredits Details of the item CLM1243657:
Content title:
APC sequenceContent description: Clip length: 29,93 sec. Description: APC sequenceContent author: Oleg Ignatovich© Oleg Ignatovich / ClipDealer / PhotogenicaModel Release: NoCollection: CD VideoKnown restrictions: » only non-exclusive licence is available Keywords for the item CLM1243657: military <sport>Winterfight <Fighting>weaponsnowhelmetvehiclecitydefencewarvideosmokeactioninvasionSuit Of ArmourArmoured VehicleHostageconvoySwat <region, Pakistan>Russian FederationClip DealerCD VideoPhotogenica VideoThe content titled APC sequence can be purchased at the Photogenica image bank on the basis of the Royalty Free licence. All images, illustrations, vector files and motion clips can be downloaded immediately after the purchase (after completion of the payment). |
|
|