Usage, resolution, format,
size in pixels and cm Single item
purchase Within
downloads pack Download
forcredits XS
Internet, 72 dpi, JPG
447 x 335, 15.77x11.82 cm €4
Not available
Not available
S
Internet, 72 dpi, JPG
816 x 612, 28.79x21.59 cm €5
Not available
Not available
M
Web/mini print, 300 dpi, JPG
1633 x 1225, 13.83x10.37 cm €8
Not available
Not available
L
Print, 300 dpi, JPG
2309 x 1732, 19.55x14.66 cm €15
Not available
Not available
XL
Print, 300 dpi, JPG
4073 x 3055, 34.48x25.87 cm €20
Not available
Not available
Details of the item CLP3481818:
Content title:
hen ready to preparation on a yellow substrateContent description: hen ready to preparation on a yellow substrateContent author: aarrows© aarrows / Clip Dealer / PhotogenicaModel Release: no information availableCollection: CD PhotosKeywords for the item CLP3481818: close-up <technique>oneagricultureanimalwhitecarrionBirdcockDeliciouseatingcookingdietmeatfarmsupermarketKitchenpoultry <bird>chickenmealroastnourishmenttexturefreshrawmarketplacetastyfastisolatedchefculinaryfriedfoodto bakeAvianhenCuisinetasteClip DealerCD Photoscdphotos14The content titled hen ready to preparation on a yellow substrate can be purchased at the Photogenica image bank on the basis of the Royalty Free licence. All images, illustrations, vector files and motion clips can be downloaded immediately after the purchase (after completion of the payment). |
|
|